Blue Fluorescence Protein (BFP)

Brand

Description

Alternate Names / Synonyms: BFP, Blue Fluorescence Protein

Gene Symbol: N/A

Accession #: N/A

Gene ID: N/A

Gene Source: N/A

Recombinant Host: E. coli

Appearance: Lyophilized protein

Physical Form: Freeze Dried

Molecular Weight: 29.0 kDa

Purity by SDS-PAGE: ≥97%

Purity by HPLC: ≥97%

Endotoxin Level: <0.1 ng/μg

Biological Activity: N/A

Reconstitution: Reconstitute with dHâ‚‚O to 1 mg/ml

Storage Temp.: -20°C

Shipping: Gel pack

Background Information: The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK

Handling: Centrifuge the vial prior to opening.

Application

Reactivity

Photos