Blue Fluorescence Protein (BFP)
4994-100
100 µg
Brand
Description
Alternate Names / Synonyms: BFP, Blue Fluorescence Protein
Gene Symbol: N/A
Accession #: N/A
Gene ID: N/A
Gene Source: N/A
Recombinant Host: E. coli
Appearance: Lyophilized protein
Physical Form: Freeze Dried
Molecular Weight: 29.0 kDa
Purity by SDS-PAGE: ≥97%
Purity by HPLC: ≥97%
Endotoxin Level: <0.1 ng/μg
Biological Activity: N/A
Reconstitution: Reconstitute with dHâ‚‚O to 1 mg/ml
Storage Temp.: -20°C
Shipping: Gel pack
Background Information: The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK
Handling: Centrifuge the vial prior to opening.
Application
Reactivity
